PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_013081-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family WRKY
Protein Properties Length: 565aa    MW: 61634.2 Da    PI: 7.1271
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_013081-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY901.9e-28255312259
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    +DgynWrKYGqK+vk++e +rsYYrCt+++C++kkkver+++ + v+ei+Y+g+Hnh+
  NNU_013081-RA 255 SDGYNWRKYGQKQVKSTESSRSYYRCTYSNCHAKKKVERCDHTGFVTEIIYKGRHNHD 312
                    7********************************************************7 PP

2WRKY105.23.4e-33428484359
                    -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    Dgy+WrKYGqK+vkg+++prsYY+CtsagCpv+k+ver+++d+++++itYeg+H+h+
  NNU_013081-RA 428 DGYRWRKYGQKMVKGNPYPRSYYKCTSAGCPVRKHVERATDDTSAIIITYEGKHDHD 484
                    9*******************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.1E-26242314IPR003657WRKY domain
SuperFamilySSF1182901.83E-24248314IPR003657WRKY domain
SMARTSM007742.4E-30254313IPR003657WRKY domain
PROSITE profilePS5081122.756255314IPR003657WRKY domain
PfamPF031065.2E-22256312IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.0E-34411486IPR003657WRKY domain
PROSITE profilePS5081134.842421486IPR003657WRKY domain
SuperFamilySSF1182902.35E-28422486IPR003657WRKY domain
SMARTSM007745.7E-38426485IPR003657WRKY domain
PfamPF031064.1E-26428483IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 565 aa     Download sequence    Send to blast
MADDKSLGAP KEEKRVREEE EEGSKVDEEE EEDEELEEEK PLPKLQESLP CVSVPDSSSL  60
EVELRGQSSQ SETLVVPPPV PSSEKAHGPG CRTFSQLLAG AMASPTANST AASSNPMVPT  120
VPVDPTGFPM VCSPVSLDPA GFKKLKLDSV NGSPRSKAYS NLIGQFGMSH QEALASVTAQ  180
AQAQKQLQIV HPSSSAELSP TSVPQSMPSE PSPAPQEQKV PPLPQETDIC TSELDCQNSD  240
RKTKSSHMVT KTPTSDGYNW RKYGQKQVKS TESSRSYYRC TYSNCHAKKK VERCDHTGFV  300
TEIIYKGRHN HDPPRKIRCT KARRFVSSAS PVGESETIDN PVKKLESDPS TPKKELREAI  360
VPTPEKKRPI SSASNGRDDM KAEGEHVDEQ DAKRRQDTGA AYSTPLFKTV KEPKIVVQAA  420
GDVGISGDGY RWRKYGQKMV KGNPYPRSYY KCTSAGCPVR KHVERATDDT SAIIITYEGK  480
HDHDMPVPKK RHGPPSAALL IAAAAAMNSA QIKKSEALPN QRASTQWSMD IDSDLIGEKA  540
LELGGEKALE SARTLLSIGI ELKPC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A3e-30254486274WRKY transcription factor 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010265585.10.0PREDICTED: probable WRKY transcription factor 32
SwissprotP595832e-95WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLD7U1A81e-148D7U1A8_VITVI; Putative uncharacterized protein
STRINGVIT_11s0037g00150.t011e-148(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.16e-92WRKY DNA-binding protein 32